SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for sgtc|cn07094 from Cryptococcus neoformans B-3501A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sgtc|cn07094
Domain Number 1 Region: 103-318
Classification Level Classification E-value
Superfamily SET domain 2.49e-63
Family Histone lysine methyltransferases 0.0015
Further Details:      
 
Weak hits

Sequence:  sgtc|cn07094
Domain Number - Region: 411-487
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00034
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) sgtc|cn07094
Sequence length 834
Comment CNBG0940 chr07.b3501.040506 (280366..279958, 279859..279748, 279692..279606, 279536..279413, 279348..279173, 279124..279021, 278972..278887, 278834..278727, 278680..278573, 278523..278332, 278281..277766, 277713..277231)
Sequence
MGDIIEGTKPTLDDLWAGDEDQKPQTPPVSPPRSPSFKHEHKSPFPGSTSPPPASPIGEE
DLKPRTARASSSTSKVKSRKASPEEFKPVLIDDLPTAWDEAHETFEALEKCVYERKDIGL
SKENDEMMVCECVYNRHDPDADPCGPDSDCINRALYIECIAGECRAGKHCHNQQFSKRQY
ANVDVVLTEKKGYGLRASSTIPANTLIYEYIGEVVAEKTFRKRMQQYADEGIRHFYFMML
QKEEYIDATKKGGIGRFANHSCNPNCEVQKWVVGRRLRMGIFTKRDVIKGEEITFNYNVD
RYGHDAQTCYCGEPNCVGTIGGKTQTDIGTMNDLFLDALGITDEVEAMGMKGSKKKKSRQ
LDEDFVPILRPISAHEVQKVAAAIRQSMENKKMMSRLLQRIQMTDDGAMHRQLMRMHGFS
LMYMVLTELADDNEIVLLALESMNKWKLQIRNKIEDSKIEEPVKALSQSGDEKICGLAKQ
LIEYWSTLELSYKIPRVSKIASLDADDEAGTQTIAEANVVSAARRPDAWENTQEIQIDIA
PVRPRTLPVSRPRPPPPPPPLPVKKPALNSMSSTDRLKLDAIIAMAEQTVQAQAAAAAVE
ATASPQAGSSRSGSRPAEDEERRKRQKRTHMTEEELAEQKERRLRKLIGAVVVKSMNKYK
DMMEHDTFKKYARECTDTLVKKEKKRNPSYQDVKHPSLSDDKKAKIKSFTKDYTHKILKH
LKEKGKLRNPKSSSSLRTNSNDPRQAASSSTNGDTPSISTTPSQGATQRLRDGELVDDIF
GADEDMVMDLDEDTPEMQNDHPAPPSVPPATPPLPPVHVEVVDNVSTPTSQWET
Download sequence
Identical sequences P0CO29
sgtc|cn07094 XP_774448.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]