SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for sgtc|cn08256 from Cryptococcus neoformans B-3501A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sgtc|cn08256
Domain Number 1 Region: 31-135
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.02e-25
Family PWWP domain 0.0021
Further Details:      
 
Weak hits

Sequence:  sgtc|cn08256
Domain Number - Region: 244-308
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00131
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) sgtc|cn08256
Sequence length 457
Comment CNBH2510 chr08.b3501.040506 (680581..680731, 680782..680789, 680839..680936, 680988..681364, 681414..681508, 681561..681651, 681701..681786, 681838..682305)
Sequence
MSSSPARDDKPAPAKKPAPRPRAAAAKPPADHKFDIGDIVLARLRGYPPWPARIANPETL
PRNVLKTRPGKNPNLYCCQFFPAGDFSWLQNKDIKALSASDISSFLAQPHRKSSGGLREA
YQTAQDPTEWDAQQEEIHKQQEEAEANVDELEDEDEAEVVVKAGKRKREEPKRKKAAKKE
EEPKPKKAKAVSKAVSKAGDKKAVSKTEVDEDPLASDPECVKVKDWRHKLQKAFLGESMP
AEPEMSHWNEVFESIESYDSMTIEALQYSKIGKVMKKIMGLTTIPLNDKYDFTRRAGKLM
HQWQEFIDAANRGRVTNGQKKSARPPSAPSAAATAAEEETPAKEDKPADETPAEEKKEES
AEPVAEKKEESAEPVAEKKEESAEPVTEKKEESAEPVTEGKMELDEKEKEAAAEEPAAAE
KTEEVGAGEEAGAAEAPEPEAAEKPEANGEDKMQVDA
Download sequence
Identical sequences Q55N33
XP_773799.1.65578 sgtc|cn08256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]