SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for sgtc|cn06360 from Cryptococcus neoformans B-3501A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sgtc|cn06360
Domain Number 1 Region: 195-282
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.83e-21
Family Elongation factor TFIIS domain 2 0.0018
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.79e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00092
Further Details:      
 
Domain Number 3 Region: 303-338
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000794
Family Transcriptional factor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) sgtc|cn06360
Sequence length 349
Comment CNBF3560 chr06.b3501.040616 (1056954..1056886, 1056796..1056734, 1056664..1056148, 1056028..1055957, 1055903..1055794, 1055734..1055516)
Sequence
MDATTLTGHVKELNAANQAGKSDEVISLLKKLQAEVVPTEDLLRSSKAGVAVGKLRTHAT
PSVSSLAKEIVKKWRDAVEETKKKRKRAEGDEGKDVKKEKEEGNGKRVKAESMCALSPAA
ESGSDTHIHFAAGSLAATPSASTPASASTPDVKATSPPVRQPLSTIDSSRTTPRTAKSDG
VADSLRADSSEGGSVDSVRDKCVIMIYDALALDSTAERAIGIERAANKAMNFSTGNDYRA
KMRSLFLNLKDKGNPALRNEIVLGYVSTEKVASMSKDEMASESVRMLKEKIASDNLFKAK
AVGVTQAETDAFKCGRCHQRKCTYYQMQTRSADEPMTVSRYLAHMIRWY
Download sequence
Identical sequences F5HGK5
sgtc|cn06360 XP_571548.1.95466 XP_774677.1.65578 214684.CNF01160 180.m00295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]