SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for sgtc|cn08154 from Cryptococcus neoformans B-3501A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sgtc|cn08154
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.89e-32
Family spliceosomal protein U5-15Kd 0.0000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) sgtc|cn08154
Sequence length 142
Comment CNBH1520 chr08.b3501.040506 (433376..433395, 433443..433603, 433656..433731, 433787..433834, 433890..433917, 433977..434046, 434096..434121)
Sequence
MSYFMTHLHSGWHVDQAILVEEDRVVCIRFGHDHDEECMAMDETLYGVSEKVQNFAVLYL
VDITEVPDFNKMYELYDNCTLMFFYRNKHIMIDLGTGNNNKINWAITDKQELIDIIETVY
RGASKGRGLVVSPKDYSTRHKY
Download sequence
Identical sequences A0A095CB39 A0A0D0T660 A0A0D0VBE6 A0A0D0YDV3 A0A0D0Z2Q8 A0A225Y066 A0A226BCN7 E6RAP6 F5HHY5 J9VS80 Q5KBS2
162.m02715 214684.CNI01600 sgtc|cn08154 XP_003195676.1.73883 XP_012051780.1.45702 XP_572796.1.95466 XP_773697.1.65578 CNAG_04387T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]