SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_00139T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_00139T0
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000792
Family Glutathione S-transferase (GST), N-terminal domain 0.0035
Further Details:      
 
Weak hits

Sequence:  CNAG_00139T0
Domain Number - Region: 200-234
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000621
Family Glutathione S-transferase (GST), C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_00139T0
Sequence length 285
Comment | CNAG_00139 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (286 aa)
Sequence
MSDNKIQLYQFEGSVWSNAPKLALEEGGLKKDKDVRWITINLPEGENFEPNYLKINPSGT
VPTLVVGNDTFTDSISAVAEIIKIAPQRPKGKVSSGASIIEEIHSAAIDPNATLLIATDD
EDRKTKINGIPKGFLAGRQKTLDKLAANPPEEFKEFLTKKQADNKQLLEFFIAEPDEQTR
KAHYAQGQQLWNSVGDALRGFITEALTKNNQGPYVGGSEPSEVDFHLITWLARTITNTGV
EPGTNVDQAIKKLQAKTGGGAFDDSIKLYWETWSARESFKTLGIH
Download sequence
Identical sequences A0A226BQ67 J9VG04
CNAG_00139T0 XP_012046556.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]