SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_00417T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_00417T0
Domain Number 1 Region: 261-419
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.11e-57
Family eEF1-gamma domain 0.0000291
Further Details:      
 
Domain Number 2 Region: 74-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.4e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0021
Further Details:      
 
Domain Number 3 Region: 4-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_00417T0
Sequence length 419
Comment | CNAG_00417 | Cryptococcus neoformans grubii H99 elongation factor 1-gamma (420 aa)
Sequence
MAPKLTGFPGNSRVRRILSVAALAGVELEHDKSFTFASEWKTPEFLEKNPFGFVPVLELE
DGTTLRESAAIAEYIAEIGSNKNLIPSDPKLKAIVHSYQATADQEIFVPGGIVNAMLSGK
APYHKAVFQTLVDRVTGRLNVIDSILAKRTFLVGERVTLADIFVATAATSIFTTWFDAPA
RAKVPNLLRFVETIINHPKLKEIFTPIEFSEKAPAPQPPVNKEQKKKEEPKPKAEKAPKA
PKAKEEEEEEEPAVPAEPKAKNPLDDLPKSAFNLEEWKRQYSNLDTRGANGSLAWFYEKF
DKEGFSIWRVDFKYNEELTQVFMSSNQVGGFFNRLEASRKYLFGSVGVLGKANDSVITGV
LVLRGQDAEPVVNVAPDWESYSFKKLDLDNADDKAFFEGAMAWDLVENGREWADGKNFK
Download sequence
Identical sequences J9VLI9
CNAG_00417T0 XP_012046703.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]