SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_01355T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_01355T0
Domain Number 1 Region: 124-278
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-43
Family Hypothetical protein AT3g04780/F7O18 27 0.00023
Further Details:      
 
Domain Number 2 Region: 8-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-22
Family Thioltransferase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_01355T0
Sequence length 308
Comment | CNAG_01355 | Cryptococcus neoformans grubii H99 thiol-disulfide exchange intermediate (309 aa)
Sequence
MAGGIQNVTSTAEFDGIVRSLPPSRLLVADFHAQWCGPCHAIAPVLEQLAGAESRQKIDV
DQQRELASRFRITAMPTFKLLKGGKEVDQLRGASPPQLSQLISRHAGTAPPPTATASSGS
KSQAATGEITESLLKQVISKGLNCLNEAKEHPLSSILGPEKGPRGNSYLESDVDPELLIS
IPFQDPVKLKAISIFSGISPSQAPKTVKLFINQPNMDFDDAENEAPAQELILTPEQVKGD
RIPLRFVRFQNVRSLHILVKDNQEDEETTRIDSIDVYGAQGEKLDPNSTSQSSAGGGSML
EKLLASGK
Download sequence
Identical sequences CNAG_01355T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]