SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_01417T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_01417T0
Domain Number 1 Region: 11-131,170-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000534
Family Thioltransferase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CNAG_01417T0
Sequence length 212
Comment | CNAG_01417 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (213 aa)
Sequence
MSVPQKIAFTRIGAAHSPSTLEVYVDPVCPFSRKITESIDKNVLPMITNGGKYDGKVNLI
MRLYPQPFHYYSAPIIEALYVFGQTNPRLFWQYLLAVHSTGTTFYNRPAASLTLSSLRDK
LVEIAVQVLDKNEAGGKGPKSKIFGELRDALEVKASDNGGNEGTEGLKYSLKLGRQNGIQ
VTPTALWNGLKDESVSSSYGKEEWEKYFTLRL
Download sequence
Identical sequences CNAG_01417T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]