SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_01889T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_01889T0
Domain Number 1 Region: 171-309
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.57e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 30-86,129-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000016
Family Glutathione S-transferase (GST), N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_01889T0
Sequence length 330
Comment | CNAG_01889 | Cryptococcus neoformans grubii H99 glutathione S-transferase (331 aa)
Sequence
MPTSANRIHNNADEKGNFNRQVSSFRDAIQPGGQFPPEKGRYHLYVAFGCPWAHRSLIVR
RLKGLEDFIDISIVHPHLHEGGWHFVTPEAAAHPAPVSEHPDTSFPGATQDHLFGFSHLS
KIYYKANPDYNARFTVPVVWDKITGTIVNNESSEVIRFFNSAFNELLPEGKGKDLDLYPE
ELRGEIDELNEWVYHDINNGVYKTGFATTQEAYEKAVIPLGKALERINERLSDGREFLVG
GRLTEADVRLYTTIVRYDPVYHSHFKCNTGLIRHDYPHINRWLKNLYWNYPAFKDTTNFD
HIKDGYWYSQINLNPTRIVPIGPKHNVEPL
Download sequence
Identical sequences J9W1V7
CNAG_01889T0 XP_012052829.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]