SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_02033T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CNAG_02033T0
Domain Number - Region: 25-69
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000313
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_02033T0
Sequence length 158
Comment | CNAG_02033 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (159 aa)
Sequence
MPAPVSQTFAALRSATASLPLSPSVKSITLSFVAKNAGPGPRQFLRHHAPALAYANPLLP
IAIRRIPDPRSKDQDPSSPHREAVKLGRWGGVADGLQLGKGNVPGGEMVVEFHNAPAQTL
PLAHLSGQQILDQLLAIALEKKVPRVAGSEVDKEALRS
Download sequence
Identical sequences A0A226BHP2 J9VQU9
CNAG_02033T0 XP_012049887.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]