SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_02496T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_02496T0
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.47e-32
Family DsbA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CNAG_02496T0
Sequence length 245
Comment | CNAG_02496 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (246 aa)
Sequence
MKIDITSDVICPFCLIGVKQLLAAIDKYKVTHPDAEFNIRFLPYELNSNLTEEPIPRKQF
YITKFGEEKAAQILSMLPAKYEAVGCKCDLSGDISSTQLAHRLQTYALCHRPSAQLPLVL
DIFTGFHSEAKHPSDKQWLTSLAVKHGVFPDEKAAREWLDGKQCDKEVKKAYGTARDLGV
TGVPFFVFQDKYAASGAMGTEEFVRLLEEIDQREKVFSEKSAPALKGGETCTDEGPYPFV
GNNGC
Download sequence
Identical sequences J9VLH6
CNAG_02496T0 XP_012050182.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]