SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_02503T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_02503T0
Domain Number 1 Region: 24-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.59e-55
Family Glutathione peroxidase-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_02503T0
Sequence length 185
Comment | CNAG_02503 | Cryptococcus neoformans grubii H99 glutathione peroxidase (186 aa)
Sequence
MTFFDSIASKFGYESLPGDIATKSFYDLKAKLPGSKGDLDFSTLKGKVVLIVNTASKCGF
TPQYNGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCTLNHGVTFPLMKKSEV
NGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLVNKEGKCVGRYGSSTKPEKLKEE
IEKLL
Download sequence
Identical sequences J9VRS7
XP_012050189.1.45702 CNAG_02503T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]