SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_02674T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_02674T0
Domain Number 1 Region: 214-336
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-22
Family Thioltransferase 0.0083
Further Details:      
 
Domain Number 2 Region: 473-618
Classification Level Classification E-value
Superfamily ARM repeat 0.0000864
Family MIF4G domain-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_02674T0
Sequence length 643
Comment | CNAG_02674 | Cryptococcus neoformans grubii H99 dJ347H13.4 (644 aa)
Sequence
MSKVQLYVYDLSHGLAKSMSLMLTGKQIDGIWHTSVVAFGREIYYGQGVLESKPGATHHG
QPLQIIDVGETHIDEATFNEYLSSLGEMYTPSKYHLIEFNCNHFTADVVGFLTGAEIPAW
ISNLPSEFLSTPFGQAMKPQIDAMFRGPTAQRPIPDKISSSNASPSPSIGSSSAPGGHTA
AAGPSLASTLLQSVAAQATAQATGQSTAASGSSRQPLNPETSPLTLVSSTVNFHSILSQH
SAVVVNFTNTPSCPPCRVIKPVYESIASYHSAVYGVKGARFVEVELGVGQGREIAGAYGV
HATPTFIFFKDGKKIDEMKGAAKRELENKVEQFLEECYPTHPHRKMYLPAVEGLPKRAIT
VSNLPNYPALLNKLEGFLAGKRKTESFMVLKNEVVPFLEGKNLSETELAALLQKWFAATQ
DLLSALQPTETFPLIDLWRIALQCQPIIPFLGLGLSTASNNAEPIIGIISLVSDTFASSP
EAIPKPFILTVLRFLTNLTSCVELTNLVLAHDGNVSTCEQLISVLVESLLYPDVGVRSAA
AGVAFNIGLWRHHNVVEETPSVDWELEMISGLVEALDREEDEDVAHRLLAALALEIYLSP
SYEDNVQPMLQVLETSNKIEKRCKVWKRKEVKKLGEEIARKLC
Download sequence
Identical sequences J9VIJ8
CNAG_02674T0 XP_012048062.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]