SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_03958T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_03958T0
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000867
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_03958T0
Sequence length 260
Comment | CNAG_03958 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (261 aa)
Sequence
MTPPIVTIYVTSLTSAPAVRRHHDLLRSSLNAMDIKYEEYDLVMDEEAKRRWQRAKPAGK
VIGLPGYLVGGEWIGTMEDFEEAVETQSLESFLKQDLNIPDEAPTIPDPSAPSASKQKSM
QEVELEKIMGEMTNEDLDKLMNDLGVSDDVGKVGLINQSSSGIDIKSWGGEGGVSKGLAP
TNGEDVISKFLHQDEKKDENKDTNEGAGGYDNIKKAKDEITDVLEDEKKLVSELKKEYEL
DGREEKDIALAEKKEVGKLD
Download sequence
Identical sequences CNAG_03958T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]