SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_03985T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_03985T0
Domain Number 1 Region: 36-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.09e-31
Family Thioltransferase 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_03985T0
Sequence length 152
Comment | CNAG_03985 | Cryptococcus neoformans grubii H99 monothiol glutaredoxin-5 (153 aa)
Sequence
MVFARLGLRTLRSLPQSQVARSTTILAQRRFLSAEARKLIDGAVKSNPLVVFMKGTPDAP
QCGFSRAVCQILDVQGVPRENLKTYNCLEDQELREGIKEYSEWPTIPQVYIKGEFVGGCD
ILLSMHQSGELEDLLIKEGLAPPLPEGPESSA
Download sequence
Identical sequences A0A225ZTV9 J9VP75
XP_012047594.1.45702 CNAG_03985T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]