SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_04110T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_04110T0
Domain Number 1 Region: 126-243
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.01e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 30-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000348
Family Glutathione S-transferase (GST), N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_04110T0
Sequence length 275
Comment | CNAG_04110 | Cryptococcus neoformans grubii H99 glutathione S-transferase (276 aa)
Sequence
MSASAVPSSPIPSTRLPESFSPEATTITPKLHLFTAATPNGYKPSILLEELHAAYPDNTE
IVYDFTQLRFDHTDQKKPEFLKINPNGRIPALVDENVKGGHNVFESANILLWLVERYDKE
YKFWFKDPLEKSQALSWIFFAHGGVGPMQGQANHFFRYAPEKIPYGIKRYQDETARLYSV
LESQLAKPDSQGYLVGRKFSVADINVFPWVRSYSWAGVDITPFPNVAKWLERIEARPATY
KGLGVPERGKGKRSKEEEEEDAREASKWIMDGQKK
Download sequence
Identical sequences CNAG_04110T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]