SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_04128T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_04128T0
Domain Number 1 Region: 12-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-31
Family Phosducin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_04128T0
Sequence length 226
Comment | CNAG_04128 | Cryptococcus neoformans grubii H99 GTPase inhibitor (227 aa)
Sequence
MSRSPSPTLSDSALLDSLEDSFDYSAHREARMEALSRQIKQVKDLRESEYGRIVEFNEEK
ALIERMAKEKYCILHFVHPNFKRCDIMDRHLSQLASKHKHTLFLRANVDNVPFLVTKMAV
KVLPCVMSYVDGRAVDRLIGFEELGQSDNFTTKALEFRLSQTGVLPTDLTLATNVSASIL
THKQQGSRPGSEGEDSEEERDRRRGKSGIRSGFRNKRGGESGDDDW
Download sequence
Identical sequences J9VW59
CNAG_04128T0 XP_012051603.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]