SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_06238T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_06238T0
Domain Number 1 Region: 105-237
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.18e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 35-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.6e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_06238T0
Sequence length 256
Comment | CNAG_06238 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (257 aa)
Sequence
MPMPDEHIHPTATGLAKKIVDAHQDPQDLVFWSGWRIWIALEERKIPYQYHEVNPYKKEE
TFLKLNPLGLVPTLEIKTAQGSKALYESDVLAEFLEDLYPPSEEHPSIFPSDPYEKSWVR
LNIQHVSKKIIPNYFKLQQSQTESDQDAARKELISALRTYAKRIKGPYFAGEQWTAVDGA
LAPFVERLYILEKHRNFDEKEVGDGWWEYRERLMARDSLKNTSSEEQYYEEILGRYLRNE
AQSEVAKATRAGQSLP
Download sequence
Identical sequences CNAG_06238T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]