SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_06240T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_06240T0
Domain Number 1 Region: 21-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.32e-36
Family PDI-like 0.00084
Further Details:      
 
Domain Number 2 Region: 360-468
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.94e-30
Family PDI-like 0.00085
Further Details:      
 
Domain Number 3 Region: 231-359
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.75e-23
Family PDI-like 0.00014
Further Details:      
 
Domain Number 4 Region: 134-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000253
Family PDI-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_06240T0
Sequence length 492
Comment | CNAG_06240 | Cryptococcus neoformans grubii H99 dolichyl-diphosphooligosaccharide-protein glycotransferase (493 aa)
Sequence
MKFSPKLSLALVAALPNLASVLASDVIDLTQSTFQKEIAGEDLALVEFFAPWCGHCKNLA
PHYEEAATELKEKNIKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGI
ISYMTKQSLPAISDVTPESHDAFIKSDNVVLVAYGDDAHPVPEAFKQYAKGARDSYLFGQ
YLSSDLPSIPESPSLPAIVLYKDFDEGYAVFPSGEIAHADVDELSEFVKQNSMPLFDEIS
PENFGSYAEQGIPIAYLFADPNEASAREKLVEELKPLAKELKGSVNFVYIDAIKFIDHGK
SLNLPGDSWPAFVIQDLADQTKFPLTGKATAENIKDFVKKYVVGEVSPSIKSEPIPATQG
PVYKLVADDWDNVYGDESKDVFAEFYAPWCGHCQRLAPIWDTLGEKYAGNNNIIIAQMDA
TENDIPPSAPFRVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETHRKSDADVAEEEW
ENEDETPEHDEL
Download sequence
Identical sequences J9VW50
XP_012053226.1.45702 CNAG_06240T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]