SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_07032T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_07032T0
Domain Number 1 Region: 64-224
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.49e-25
Family Glutathione peroxidase-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CNAG_07032T0
Sequence length 224
Comment | CNAG_07032 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (225 aa)
Sequence
MSFRIATATARAIPARAAATRSIMTLRRVTIPQVSPKGYRQSSILQDTAKTAHSAFANLA
SAAPIKKGDKMPDVEIKIDGPEGKVNLGKEKGKNVVVLVPGAFSGVCSNQVPPYITSFSD
FKAKGINNVYVVAVNDIFVVNAWKDKMLGEFGSKEAEGVKFAADDTAALASALGLTFDAQ
PVFGGPRLKRGVLVVNDGAVEYVGVEDSPGDITISAADKVIKQI
Download sequence
Identical sequences J9VWB4
XP_012053921.1.45702 CNAG_07032T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]