SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_01470T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_01470T0
Domain Number 1 Region: 51-226
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-52
Family NQO2-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_01470T0
Sequence length 249
Comment | CNAG_01470 | Cryptococcus neoformans grubii H99 NADH-ubiquinone oxidoreductase 24 kDa subunit (250 aa)
Sequence
MSFARSAIQSARNTLARPTRRTFVSSTSRLSDSLFVHRDTDYNNPSIPFEFTPENLKRAH
EIIARYPPQYKKAAALPILDLGQRQNQGWTSISVMNAVAKLLDMPKMRVYEVATFYTMYN
REPVAPNFVQLCTTTPCQLGGCGSTKILETIESHLGVHPGQTTKDGKFTFVEVECLGACS
NAPMMQIGDDYYEDLTPETTVKILDALARGEKPKPGPQSGRQTSENSAGLTTLTTKPYGP
GEFCLPEFQ
Download sequence
Identical sequences J9VT93
CNAG_01470T0 XP_012052544.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]