SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_01893T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_01893T0
Domain Number 1 Region: 174-311
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.64e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0094
Further Details:      
 
Domain Number 2 Region: 30-86,130-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000816
Family Glutathione S-transferase (GST), N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CNAG_01893T0
Sequence length 331
Comment | CNAG_01893 | Cryptococcus neoformans grubii H99 glutathione S-transferase Gst3 (332 aa)
Sequence
MSTENKDITSWASKDGSFKRQASSFRDFIEPGGKFAPEKGRYHLYVSLACPWAHRTLIVR
KLKGLEDFLDVSVVHPHMLEGGWHFVPKDKASAKPAPASAHDNDTFPNATSDPLFGVSHL
RDLYFKAQPDYSARFTVPVVWDKKENTIVNNESSEIIRFFNTAFNGELPADKAKLDLYPE
DLKKEIDELNDWVYNDINNGVYKSGFASTQDAYEAAVKPLAKGLQKVEDRLSDGREFLMG
DRLTEADVRLYTTIVRYDPVYYVHFKCNFGLIRHDYPNLHKWLQRLYWNNPAFKDTTDFD
HIKEHYYYSHAQINPNRIVPFGPNVNIEPLK
Download sequence
Identical sequences CNAG_01893T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]