SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_01939T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_01939T0
Domain Number 1 Region: 377-455
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000534
Family Glutathione peroxidase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CNAG_01939T0
Sequence length 688
Comment | CNAG_01939 | Cryptococcus neoformans grubii H99 fmHP (689 aa)
Sequence
MLHSLQPQNAPNDLGRSNSVYSSLSPAANSLPSSSFSARPHSAFEATTPPARHSFLLPSV
DHSPSSDGHSPHQSQALHRPPSLPNAAILLEHGSVRNSNLCRSHSTRSARTKSIRRKPVP
TMPLPMQDKEFTIGLGLPPNHPFANVASQAMTRSSSSYGYESMRYSTEKIDNRFGTGSQL
ANRAPFPRRDTSPHFSEQHVQQLHSRVPEYTLSVNRPLPPAPTDTASIRSAHTAPLSAAT
HGGRSSSSADSVRIMTPIHSSTHEQAVHNRDSSHRSVHNVPSSVPPIMPKRLMSDDVVVR
SKGSKKVQQKIKVPKKVILLGGETLADVEFSVDKLVSRDRVLEASTCFVRDENGLPICFG
DLLSPPGPVEAGKPTPKTVVFFIRTFWCGQCQDYTLASISILSPEALEKAGIKVVIIGHG
SWKVLKAYRRLFNCPFPIYVDGPKKLYSLMGMTKGAPKTAPWGHFWKGRAEYHQRAVPGQ
LNALFKMPVKPPGDLTQLGGEFIFSPGSVCEFAHRMTHASGCDHPTVEEIKAVELAESQR
EELGKLRVEMERWKKERAAELEGIKMRKAARRGIPYSRSLEIGPQMAQAHDFEFDFEDGL
EVAYEEEDEDETEALEMGEHWDERFRRVISLEQQVSRKEEKETSAGIGKRVMETPLGHEA
RGQQRDDEVEMISPEGNGNLHVHIGPAS
Download sequence
Identical sequences CNAG_01939T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]