SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_02854T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_02854T0
Domain Number 1 Region: 18-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.15e-32
Family Glutathione peroxidase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_02854T0
Sequence length 167
Comment | CNAG_02854 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (168 aa)
Sequence
MAPHEDNEEHEDEEDGEVLKKGDRLPSIKLKDEEGNTVDVSTLAGEKGVVFFLYPKADTP
GCTNQACGYRDMFDEIAVFGYEVYGLSKDTPTAQQKWKAKKSLNYHLLSDPKSKLIKRLG
AFVPPKNTKRSHFIFEKGTGNLIDIDIGVRPAEDPNNVLGFLTEKYL
Download sequence
Identical sequences CNAG_02854T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]