SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_02927T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_02927T0
Domain Number 1 Region: 24-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.42e-27
Family PDI-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_02927T0
Sequence length 388
Comment | CNAG_02927 | Cryptococcus neoformans grubii H99 thioredoxin family protein (389 aa)
Sequence
MKLDWFAVITAVLLPLSAYAGMYSQPVLHLDSKTFKSVMANEHAAMVAFVAPWCGHCKNL
GPEYTAAAQSLSPLIPFYAVDCDESSNRGLCAEYGVQGYPTIKGFPKAGKGAAKEYNGER
KRGALVEYAKGLVPERVKKLRVQGDIQSDVQGFLGEKSELPHVLLVHPSSPSIPFLWKVL
AHRFSNKLHLGYVRDTTSHDVLSLLGIYDSADTTRDSTRVVAWSPGSQRGEFVEYDGILK
FNALLEWLQTTFTSAAPSNTKQRPIKAPQPTVKSTNKEKEQIPTQAQNDAAARRAKLEEM
ERRDKARREKAAEAARAQAMATEPEPETEKEATPVEDAADAAPAQVIEDASLPMEEVESK
PVPEEAPDDEASARDVEVEKTEVVHEEL
Download sequence
Identical sequences J9VPY2
CNAG_02927T0 XP_012048225.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]