SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_03848T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_03848T0
Domain Number 1 Region: 285-374
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000796
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_03848T0
Sequence length 412
Comment | CNAG_03848 | Cryptococcus neoformans grubii H99 glutathione transferase (413 aa)
Sequence
MPNHNHHPPNDTTPLPTSSVSFSDKSDYSPTSSVTSSEVRLSDQLPSPKFATSRGLSLLP
PSHPLRAQLCTQVEGEMSPPRTPKGHPMDQPPKSYFPFPSSKATKHRSQGITNPYGSDNP
SYPIGITYLLRIPRRLRPYLLIAFCLFTFGFILVNKAVSASQSTSAIVIQKQFSHSAHKY
IPIESLHGIDDGSSHLLSSQQATDASVVEVDAQATKDHAEIFRFESVEEELAALISFVTS
TTSNVIPQVDPSVPLDPSVILDFDPLHPNARDDLHLLQTEINALYPLVLFGRMRDPHHRE
IKRLLSEVKITPAPLIVEVDQRKDRNVFIPTVARLLGDELPVITLQGKRLGGYKEIMAMH
EAGTLNDRLQKGGAVLVREIKKKMKGIKEQERIENERVLGPAPVVGDEQAEE
Download sequence
Identical sequences J9VL72
XP_012047494.1.45702 XP_012047495.1.45702 CNAG_03848T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]