SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_04063T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_04063T0
Domain Number 1 Region: 111-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-18
Family Selenoprotein W-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_04063T0
Sequence length 218
Comment | CNAG_04063 | Cryptococcus neoformans grubii H99 selenoprotein W (219 aa)
Sequence
MPENCKDCDQYPTQPASSTAMSRGVIAPECSLPGADVASPLSLSYVSSQTQAQDQTEVQP
RLKVGAGEAKVEGLENKDEGTGTSTPSASASATVAMLAGQGFKAPDLREVKPSVIIEFCD
RCRWAPRATWIQTELFLTFPNPILRSITLMPLNAPETGGRFRVWVDVGKGMGDELAWDRK
TEGGFPELKVLKQRIRNLVQPDMGLGHSDVHGKTGEAK
Download sequence
Identical sequences J9VHB6
CNAG_04063T0 XP_012047652.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]