SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_04508T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_04508T0
Domain Number 1 Region: 21-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000021
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  CNAG_04508T0
Domain Number - Region: 160-242
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000681
Family Glutathione S-transferase (GST), C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CNAG_04508T0
Sequence length 252
Comment | CNAG_04508 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (253 aa)
Sequence
MAKYTLYQLIGKSEHTDGRVISPHVWKTKLDLAYFGQEVKAEGKTFPQIRGELAETTKNS
AVTVPTIVDEEGLVITDSWKIAEYLEAKHGSAEKSVFGGQVGKEFAKFIEIWSNATLANE
FRPLIASAIFELFDEPSKNYFIKSKFGGDLSRFEAHKSKFSDPSNINAQLTAARTRLTVI
ETLLGYKKEKAEPLWLSGKPSHADFCLFGWYAASRINPAVERGVWRHEENPLVGEWLDLI
LRSGLVDQAQFD
Download sequence
Identical sequences J9VRX5
CNAG_04508T0 XP_012051845.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]