SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_05001T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_05001T0
Domain Number 1 Region: 25-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.08e-17
Family Txnl5-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_05001T0
Sequence length 119
Comment | CNAG_05001 | Cryptococcus neoformans grubii H99 hypothetical protein (120 aa)
Sequence
MPLQTAPYPHVFNALNGPTAPAVSYIVFYSNIVDGQMWCPDCRAVENVVKETFDTPDKPN
AAIFWVGNRQEWRTPNNQARTEWNVNSVPTILRLENGKETGRLVEDEILDKARLQAFIK
Download sequence
Identical sequences J9VLD8
CNAG_05001T0 XP_012048651.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]