SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_05720T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_05720T0
Domain Number 1 Region: 7-222
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.78e-32
Family Phosducin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_05720T0
Sequence length 287
Comment | CNAG_05720 | Cryptococcus neoformans grubii H99 GTPase inhibitor (288 aa)
Sequence
MVNPDEDTEFNDALRRHGILPPKPPSRSPSPDIPHITHTDAVRAVAATADADQLVTLIEG
DNVDSDDERMFEEYKRKRLHEMKKEEKKGRFGSMEPLGREDFVKEVTEGSKADPDGEQIE
DQDDDDEESSPRLKGTGVVVFLFKDSVPLSQHLRPLLNQAAAAHPSTKFLSIPAGLCIPN
YPDKNVPTLLIYRNGEMIGNVVAGMGLKGMKTTVRDLEGLLLYFKAVEKPSAALLRSSEA
IERLDSDDDFNDDVGTVNTRGGGLRTGGVDIGAGRGKEDSDDSDFDM
Download sequence
Identical sequences J9VP64
CNAG_05720T0 XP_012050471.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]