SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_06215T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_06215T0
Domain Number 1 Region: 313-388
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000047
Family Thioredoxin-like 2Fe-2S ferredoxin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_06215T0
Sequence length 406
Comment | CNAG_06215 | Cryptococcus neoformans grubii H99 conserved hypothetical protein (407 aa)
Sequence
MFGKLSSAISSFTTGSLPPDHHAPEREKTNAVLAQKLAEAHVPVSESDCVSCGLPCSVGS
GTESGAGTVVEAYSGKPYEEYVEEKYGEIEGLPKGFEQDWETDLAGSAKGGKGRVVVIST
GKSDWERDHTVGLHFQLTLGRCSTTNKDFLPYISSSLFPPPSRPLSSPISAPPSLYSSSL
ISQSNDPIDQSVLVFPDWKVVHEVETSKEGAKELYESVLSGELGRAGKEGKGEEGVERKR
SWVMPYRAIVLLCSHKRRDKRCHIAAPLLRSALHTCLIAHDIAIDETGSSLVNLDGPPLE
EVSGTEEDREREVGRRIKGIEAVNGGDGGEVGIFNISHLGGHKFAGVMLILFPSGAYISY
GRVTPQEIPRVVEDTILKGKIVPGLLRNAVGVTRAGEKADKGFLGW
Download sequence
Identical sequences CNAG_06215T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]