SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_06287T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_06287T0
Domain Number 1 Region: 13-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.91e-46
Family Glutathione peroxidase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CNAG_06287T0
Sequence length 151
Comment | CNAG_06287 | Cryptococcus neoformans grubii H99 glutathione peroxidase (152 aa)
Sequence
MSDIYSYSVEFPKSTLPLSDLKGKTLLFVNVASKCGLTPQYKDLQALHEKYGDKGLAIIG
FPCNQFKAQEPGTDDEVLQFCQLNYGVTFPIAKKGDVNGENTQPIWKYLKENAEPPVSDI
DWNFSKFLVKDGKITWFPARSTKVSDVEAAL
Download sequence
Identical sequences A0A0D0VD14 A0A225XGB6 A0A226BA74 J9VVN8
XP_012053381.1.45702 CNAG_06287T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]