SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CNAG_06494T0 from Cryptococcus neoformans var. grubii H99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CNAG_06494T0
Domain Number 1 Region: 181-350,407-591
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.3e-50
Family Cellulases catalytic domain 0.051
Further Details:      
 
Domain Number 2 Region: 10-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-27
Family Thioltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CNAG_06494T0
Sequence length 745
Comment | CNAG_06494 | Cryptococcus neoformans grubii H99 cold-induced thioredoxin domain-containing protein (746 aa)
Sequence
MSSTSAADPTPRLSNVLAKSKSPYLLQHKDNPVAWQEWSPETIALAQKLDKPIFLSSGYS
ACHWCHVLAHESFEDEETAKMMNEWFVNIKVDREERPDVDRMYMSYLQAVSGGGGWPMSI
FMTPKLEPFFAGTYFPRPNFHQLLNKIHEVWEEDREKCEKMGKGVIEALKDMSDTGRTSE
SLSQLLSSSPASKLFAQLSTMNDTRYGGFTNAGSSTRGPKFPSCSITLEPLARLASIPGG
GARNAEIREDAREMGMKMLRSMWSGGIRDWVGGGMARYSVDEKWMVPHFEKMLYDQAQLV
SSCLDFARLYPANHQDRLLCYDLAADILKYTLRDLKSPEGGFWSAEDADSAEYKGAKKSV
LPEGAFYIWKKTEIDEILGDDAPLFDSFFGVEPDGNVNIIHDSHGEMRGKNILHQHKTYE
EVALEFGKREDQAKDIIIEACEKLRLKREERERPGLDDKILTAWNGLMLTALSKASTLLP
SSYGISSQCLPAALGIVNFVKSHMWDPSTRTLTRSYREGKGPQAQTDDYAFLIQGLLNLY
EATGDESHVLFAEELQKRQDELFWDDDDGGYFASAEDAHVLVRMKDAQDGAEPSAAAVSA
HNLSRFSLLLSSEFENYEARAEATFLSMGPLITQAPRAVGYAVSGLIDLEKGYREVIVIG
SANDEMIKEFLKAARETYFSNQVIVHIQPEKLPKGLAEKNEVVKALINDVESGKEKEASL
RVCEGGTCGLPVKDLEGAKNLLKDV
Download sequence
Identical sequences CNAG_06494T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]