SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|103766|estExt_Genewise1.C_180024 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|103766|estExt_Genewise1.C_180024
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.65e-27
Family YKR049C-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|103766|estExt_Genewise1.C_180024
Sequence length 135
Sequence
MFKFLQPKVLDTITLFHKASNPASIRIATLLKQAAGSGAAVSDNAPAKKSDFELNITEEA
PTTEQLRTMLDYVGKTGISSIISNAQNETEALKKFKENGDNLNRPIVVDWNNGKVFTGDN
ESAILKLLEGLPKKN
Download sequence
Identical sequences F8N134 G4UBJ6
jgi|Neute1|103766|estExt_Genewise1.C_180024 XP_009856691.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]