SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|109685|estExt_Genewise1.C_580005 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|109685|estExt_Genewise1.C_580005
Domain Number 1 Region: 24-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000727
Family Glutathione S-transferase (GST), N-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 169-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000032
Family Glutathione S-transferase (GST), C-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|109685|estExt_Genewise1.C_580005
Sequence length 251
Sequence
MANQDQITFFDIPSKDGRTWTLNPWKTRFALNYKSLPYHTQWLEYPDIRPTLSPHLPPTA
PEPSTSSYTIPAIRFPDGTYMMDSKPIAVALEERYPAPQYPSLHLDTPALAKLESLMPGM
MGKLVGVFVPGAVKNILGPKSQPYFKSTREAAFGMSIEELEKTQGGVQAYEKIREELSEV
TALLKKGQTSAGGPFFEGDKVSYADFVWAGFLLFMKYADAEGFDKLLEATGDKEANEKLL
EGVKPWARDDI
Download sequence
Identical sequences F8N2C7
XP_009856912.1.73169 jgi|Neute1|109685|estExt_Genewise1.C_580005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]