SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|111004|estExt_Genewise1Plus.C_10869 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|111004|estExt_Genewise1Plus.C_10869
Domain Number 1 Region: 95-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.18e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.00098
Further Details:      
 
Domain Number 2 Region: 8-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.5e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|111004|estExt_Genewise1Plus.C_10869
Sequence length 253
Sequence
MASQNSDIHLYTAQTPNGIKVSILLEELGVPYKVTAIDISKDVQKEPWFLEINPNGRIPA
LTDKLEDGTPIALFESGAIMQYLVERYDKDHKVSYPQGSKEYYQTQSWLFWQMGGLGPMQ
GQANHFTRYAPEKIEYGINRYQNETRRLYRVMDAQLAKNEYLVGDRPTIADFSCWGWVAA
HGWCGIKNFEAQFPHLNAWLNRLLERPGLEKGRHVPSKHTALELNKLSEEELEAKAVSSR
AWVQKGMAEDAKK
Download sequence
Identical sequences F8MCE7 G4UHU0 Q8NIW8
jgi|Neute1|111004|estExt_Genewise1Plus.C_10869 5141.NCU04109.1 XP_009847250.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]