SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|117319|estExt_Genewise1Plus.C_80355 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|117319|estExt_Genewise1Plus.C_80355
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.71e-38
Family DsbA-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|117319|estExt_Genewise1Plus.C_80355
Sequence length 233
Sequence
MTHFQIKVVSDIICPWCYVGKARLERAIKLYKDVIPGGANDTFTVTWHPFYLDPSLPKTG
GIDPKAYLGKKLGSPERLAMVHARLKAIGEGEGINFSLNGRIGNTRNAHRLIQLSKTKSN
EVENKTAAALFQLHHEEDGDVSSNDMLIAAGKRAGLDGAEVESWLASDRGGEEVDREVAE
AQRKGIHGVPNFTINGQSELSGAQDPETFVQEFLRVKAATSDVSERPSDGPTC
Download sequence
Identical sequences F8MUR8 G4UY49
jgi|Neute1|117319|estExt_Genewise1Plus.C_80355 XP_009853540.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]