SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|121949|estExt_Genewise1Plus.C_170457 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|121949|estExt_Genewise1Plus.C_170457
Domain Number 1 Region: 6-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-27
Family DsbA-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|121949|estExt_Genewise1Plus.C_170457
Sequence length 225
Sequence
MVPKPKITLYLDTVSPFAYEAYHILRNDPIFKNVDIKYVPIFLGGLMNKCSNTPPIKIKN
KDKWINVERLRWAHAFSVPIVTDMPPNFPPNTLPVQRVLAGIEASSQSQSAVIAALDALY
KSYWALGQPIYEPAQLRSVLASSLGGEEAADKVLGAAQTAEVKQRLVENTDKAFAEGAFG
LPWFTCTNTKGETEGFWGVDHLGQVVQFLGLDKGVSGNGGWKSVL
Download sequence
Identical sequences F8MQ08 G4USX1
XP_009852036.1.73169 jgi|Neute1|121949|estExt_Genewise1Plus.C_170457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]