SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|122131|estExt_Genewise1Plus.C_180139 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|122131|estExt_Genewise1Plus.C_180139
Domain Number 1 Region: 29-216
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.95e-16
Family Thioltransferase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|122131|estExt_Genewise1Plus.C_180139
Sequence length 219
Sequence
MALPPKFAGHRFIPTEGAGASSFPTQPLHTVEIFLDYVCPFSAKIYNTLYTTLLPSLRSE
HADLGSKVQFIFRHQIQPWHPSSTLTHEAGLAVQRLAPTKFWDFSAALFKDQKAYFDVSL
VNETRNETYKRLAKLASQSAGVDERELYELLAIPTEKGDDGSLNVGNAVTNDLKTVIKMA
RLVGVHVSPTVILDGVVAGEVSSSWTLEQWLEYLRKSVA
Download sequence
Identical sequences F8N1E2
XP_009856745.1.73169 jgi|Neute1|122131|estExt_Genewise1Plus.C_180139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]