SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|155009|estExt_fgenesh1_pg.C_20343 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|155009|estExt_fgenesh1_pg.C_20343
Domain Number 1 Region: 24-280
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.6e-95
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000000413
Further Details:      
 
Domain Number 2 Region: 370-540
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-62
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.000000296
Further Details:      
 
Domain Number 3 Region: 282-363
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000000844
Family Rhamnogalacturonase B, RhgB, middle domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|155009|estExt_fgenesh1_pg.C_20343
Sequence length 540
Sequence
MGFLTLFHVAFLAVSLFVSGTLAAFGYTTSGNNFIIDAGSANPLIFSVSKSSCDINSIKY
RGTELQYSKQGTHIGSGLGKATVSVSQINGSTSKFIKVTCVTSTLTQYMIVKEADSTIYM
ATYITAEPAIGELRFIARLLSDKLPYEYPYGEVSTTKGSSSTVEGSDVFVVDGQTRSKFY
SSTRFIDEDSHCVYGGSDLMHVCIITPQQESSSGGPFFRDIDSNNAGDSTNLYNYMNSGH
VQTEDRRMGLHGPYLMTFSRSGIPKLKTVDVSWFGELGVTGYVPDSQRGTVIGRATGIPS
GFEGVVHWYNAAAQYWVRTASNGDFTSPKMKPGTYTMVLYQTEFKVATSTVTVSAGQTTV
ASIASTFNTSHTTLFKIGEYDGQPTGFRNADKFLRMHPSDSRMSSWGPLTYTVGSSSLSD
FPMAVFKSVNNPVTIKFNLGSAPSQATTLRIATTLAFAGARPQVVVNGWSASAPAAPVKI
DSRGVTRGAYRGYGEVYDVAVPAGKLVSGTNTITISALSGSSGATFLSPNFIFDAVELFY
Download sequence
Identical sequences F8MWY0 G4UZN1
XP_009854227.1.73169 jgi|Neute1|155009|estExt_fgenesh1_pg.C_20343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]