SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|158114|estExt_fgenesh1_pg.C_140098 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|158114|estExt_fgenesh1_pg.C_140098
Domain Number 1 Region: 90-216
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.0081
Further Details:      
 
Domain Number 2 Region: 5-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000307
Family Glutathione S-transferase (GST), N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|158114|estExt_fgenesh1_pg.C_140098
Sequence length 230
Sequence
MAPFATIYTYPNNVRVQRAQAVAKLNGLEIVEDSDFQLANPSDPKWAAILAKFPYGKVPA
LSTTDGSLNLTEGQAIVRFLADSGPKSEQLLGRTAVDRALIEQWACFAEQELLTNLYPCM
LMVHRPDLVPYTPEGYDASAKKFERAVKHVENTLAKGNGKFLVGEEVTVADVMVAGALIL
ASKLLLDAEMKKSAAPSVEGYLKGLLEIPELKESFGELVTVQERLRGKTE
Download sequence
Identical sequences F8MSY2 G4UX12
jgi|Neute1|158114|estExt_fgenesh1_pg.C_140098 XP_009853030.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]