SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|167238|estExt_fgenesh1_pm.C_270082 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|167238|estExt_fgenesh1_pm.C_270082
Domain Number 1 Region: 60-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000402
Family Thioltransferase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|167238|estExt_fgenesh1_pm.C_270082
Sequence length 183
Sequence
MHFLFSSGRQALPSSRRLLGKTPAAAAVTCNQFASSAASFSTSRIVAAKNQIYQSVRNLD
QFHTYQLLSSSSRTPLLTLWTTSYCPTCRVVEPLLRELVETGVGEEEGGVGFCTVEYDAP
DVMEAGLGLSYMINSIPTLLSFDAQEAQTQTKVTDGRQLANRKFLEEWYAIFLAVVKIWL
SRG
Download sequence
Identical sequences F8N3T6
XP_009855429.1.73169 jgi|Neute1|167238|estExt_fgenesh1_pm.C_270082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]