SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|176765|fgenesh2_kg.1__180__316_1_CCGZ from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|176765|fgenesh2_kg.1__180__316_1_CCGZ
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-58
Family Glutathione peroxidase-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|176765|fgenesh2_kg.1__180__316_1_CCGZ
Sequence length 167
Sequence
MSSATTIYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEKYP
DDFEILAFPCNQFGGQEPGTEEEIQSFCQLNYGVSFPIMKKVEVNGDNADPLYEWMKNEK
PGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKEAILKELGE
Download sequence
Identical sequences F8MD00 G4UHE1 Q6MVX5
jgi|Neute1|176765|fgenesh2_kg.1__180__316_1_CCGZ 5141.NCU09534.1 XP_009847797.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]