SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|179539|fgenesh2_kg.26__37__12959_1_CCGZ from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Neute1|179539|fgenesh2_kg.26__37__12959_1_CCGZ
Domain Number - Region: 12-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00246
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|179539|fgenesh2_kg.26__37__12959_1_CCGZ
Sequence length 98
Sequence
MLTRFITDVSTRFNPFSAKAKAARLFLSFLPPNARSNGMNITTQLLPRNSTETPLLYVKF
KDGKEMNLDVENMGIKSIVEEVDRHSRILQKQADLNDG
Download sequence
Identical sequences F8N0P6 G4UAV1 Q6MVH6 Q7SGH0
5141.NCU00952.1 jgi|Neudi1|154861|estExt_fgenesh3_pm.C_40447 NCU00952T0 jgi|Neute1|179539|fgenesh2_kg.26__37__12959_1_CCGZ XP_009855829.1.73169 XP_965145.1.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]