SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|187951|estExt_fgenesh2_kg.C_10147 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|187951|estExt_fgenesh2_kg.C_10147
Domain Number 1 Region: 45-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.07e-31
Family Thioltransferase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|187951|estExt_fgenesh2_kg.C_10147
Sequence length 165
Sequence
MLTRSLFSRQLFAAASRPAIAPKAVSSAFRPVLFYQNRFLSDATRQAIDKAVASAPVVLF
MKGTPETPQCGFSRASIQVLGLQGVDPNKFAAFNVLEDAELRQGIKEYSDWPTIPQLYID
KEFVGGCDIIVSMHQNGELAKLLEEKDVLVKGEEGAAEEQTEKKE
Download sequence
Identical sequences F8MCG1 G4UHS9 Q1K6V6 Q871I1
NCU04098T0 XP_009847740.1.73169 XP_960860.1.24337 5141.NCU04098.1 jgi|Neute1|187951|estExt_fgenesh2_kg.C_10147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]