SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|188364|estExt_fgenesh2_kg.C_30032 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|188364|estExt_fgenesh2_kg.C_30032
Domain Number 1 Region: 23-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-22
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|188364|estExt_fgenesh2_kg.C_30032
Sequence length 138
Sequence
MTVKALTQISSAGRNGVGAFVLQCKKLDIHYSDWAGSSRGMNGFIKSLLPKFAAANPQIE
FVVSPRPAKHPILMGHYINGRTKAICVRNMEPLEVLKKAELLRDASGEKPQKFKKPVTST
NPSVRGVWSPYHGQGMAV
Download sequence
Identical sequences F8MKR0 G4UN52
jgi|Neute1|188364|estExt_fgenesh2_kg.C_30032 XP_009851339.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]