SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|188822|estExt_fgenesh2_kg.C_50112 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|188822|estExt_fgenesh2_kg.C_50112
Domain Number 1 Region: 11-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-22
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|188822|estExt_fgenesh2_kg.C_50112
Sequence length 94
Sequence
MSGRFAFNKGLKEVRFLFCQTGEHSAATRSFLLRNYPAMKKDNPATPVLIRDASGTLPKV
YARFEFGKEKSQSLEGLSDQQIEETVSSLVKNNS
Download sequence
Identical sequences F8N414
jgi|Neute1|188822|estExt_fgenesh2_kg.C_50112 XP_009856301.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]