SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|189206|estExt_fgenesh2_kg.C_80025 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|189206|estExt_fgenesh2_kg.C_80025
Domain Number 1 Region: 99-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.92e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 7-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.48e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|189206|estExt_fgenesh2_kg.C_80025
Sequence length 236
Sequence
MADSSSLKPIKVYGHTGPNPPKVIMVLAELGIPYDLDNIQISQAKSPEFVKNVNPNGRLP
AIQDPNTDLTLWESGAILEYLTEKYDKELKLSFTPGTNDFYLARQWLYFQTTGQGPYYGQ
VAWFKRYHPEPVPSAVERYVKELNRVSSVMEDHLQTQKEKYGTEEPWFVGNKFSYVDIAF
APWQHIVGVMLTKEEYDEDKYPLIHAWLERLRARKPIKEALDNMIPAGGAPPKQNE
Download sequence
Identical sequences F8MSF4 G4UX92
XP_009853664.1.73169 jgi|Neute1|189206|estExt_fgenesh2_kg.C_80025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]