SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|155629|estExt_fgenesh1_pg.C_40048 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|155629|estExt_fgenesh1_pg.C_40048
Domain Number 1 Region: 336-441
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.66e-28
Family PDI-like 0.0085
Further Details:      
 
Domain Number 2 Region: 39-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.8e-19
Family PDI-like 0.041
Further Details:      
 
Domain Number 3 Region: 447-559
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000496
Family Thioltransferase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|155629|estExt_fgenesh1_pg.C_40048
Sequence length 814
Sequence
MRWLPLFLGAARLAVAASTTTETETEDEVKEYTKFNDVPVPPLIELTPDNWEKESKASKW
LMVKHYSPYCPHCIDFAPTYQTLYEFYYTSKPVGDENANFTTFYDFRFGTINCVAYYDLC
SAHKASSYPTTTLYKNGEQVAALKGVKSMPVLSEIVEKALEATKPGSRPAKLELPKPGEI
VAPGYVPKVAATKDTKETSNVDSAKDVPKVDLVKDSATVEQPVKDTFITGNDEYLMPTPK
TEDKAAEKVVDKVVDKAADKATETEATETKAIESKAASKADPSVEATAKIEKVKGKEEEE
EKKKSTSPAYYEAPAVAAAAAASIKGNKPKTTPNPNGISQPLTAESFQSQVTMTQEPWFI
KFYAPWCHHCQAMAANWAQVAREMKGRLNIGEVNCEQEARLCKDVRVTGYPTIQFFRGGE
RVEYTGLRGLGDFLAYAEKAIDISKGVQDVDAASFKALEEKEEVIFVYFYDHATTTEDFL
ALERLPLSLIGRAKLVKTRDPELYDRFKITTWPRLLVSREGRPTYYQPLTPNEMRGTRQV
LNWMKSVWLPIVPEMTASNAREIMDGKIVVLGLLNRDDEESFNGAIREMKSAASEWMDKQ
IQLFQLERQELRNAKQLRIEEAEDRNDQRALRNAKNIRINMDRADRKEITFAWVDGVFWQ
RWIRTTYGIDVKDTGDRIIINDEDNRRYWDQTTTGNPIVPSRTSILETITKISQNPLNIK
PKLTISAFEKLFFDIRMTFSEHPYLSMGCILGIAFGCLSWFRNSARAQRRAGHGTHFKLE
EGGIGAPSEKGSTGGFIQSVFGGSGGSSNGPKAD
Download sequence
Identical sequences F8MFI1 G4UJK2
jgi|Neute1|155629|estExt_fgenesh1_pg.C_40048 XP_009849470.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]