SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|161292|estExt_fgenesh1_pg.C_760012 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|161292|estExt_fgenesh1_pg.C_760012
Domain Number 1 Region: 1354-1419
Classification Level Classification E-value
Superfamily HMG-box 0.00000262
Family HMG-box 0.0037
Further Details:      
 
Domain Number 2 Region: 1992-2046
Classification Level Classification E-value
Superfamily HMG-box 0.0000641
Family HMG-box 0.0059
Further Details:      
 
Weak hits

Sequence:  jgi|Neute1|161292|estExt_fgenesh1_pg.C_760012
Domain Number - Region: 1658-1711
Classification Level Classification E-value
Superfamily HMG-box 0.000511
Family HMG-box 0.0048
Further Details:      
 
Domain Number - Region: 1469-1524
Classification Level Classification E-value
Superfamily HMG-box 0.00223
Family HMG-box 0.0044
Further Details:      
 
Domain Number - Region: 1753-1805
Classification Level Classification E-value
Superfamily HMG-box 0.00419
Family HMG-box 0.0071
Further Details:      
 
Domain Number - Region: 1092-1142
Classification Level Classification E-value
Superfamily HMG-box 0.00511
Family HMG-box 0.011
Further Details:      
 
Domain Number - Region: 1891-1924
Classification Level Classification E-value
Superfamily HMG-box 0.0772
Family HMG-box 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|161292|estExt_fgenesh1_pg.C_760012
Sequence length 2202
Sequence
MTGDENNGEQSSNATPNNTQPMAIAEKPAKKKRSPVKPKGRKVAKQAARPDVKEEEQAET
DVQLPEIGTSNTSIAPDDEEQNVNISDQPSANVNRARPSATSSTTSGRRVQPKSTKSNIK
AKSRSKTIAVVEPREMDDPEAEYDSDIPYIPKDLRKELRERLSWAGLTYPETWRPRVDSP
FDAPPPPPENPPPADSILVAGLADGEVGYLRQLLRYWTSEDKGCRTANKFFHRLHYTYKK
VDSLPEALARHDRVLALTLDRLARAIPFELFLCRLDRGYEDTDIDPQQVSPSYVIEDLVD
LQGRTYAKFVPVDENDWTQKTTEHRKPKLLPGYCDAALVLVPRDTVADFLWETIEANGPP
TAKYNVTQTPLRSLLENYRTLCSRSVEDHVRYWPIFSNLIRRACTWDNEKGLGFMPGELV
ESILKACISAKDWDLFTFAAGFTGFAFRKLPYDPQSFVKWARAEITEGRATFQDIQEGIL
AISVSHSLIKYRCSSITAFYETTDETVPRDWARNAVVRIADFPGWQIIGQQDGSELVSAL
KTCFRMGPDFIELATKLVRRNSTKIPFLLGFANELHETCSTENATKKLYLDLAEHILNEL
HIYKLHSRSAETARVREIIQLRSTKVTQDLKMIKAAIEGIDKADMSRFISGLIAENADTL
LMRLTMKLVGDAKRIPLRELTHLWVPFLYLLPDVLEKHHIPLSTPRYQNMFAAIMEMYLL
REVGRAPKQIWQPVMRTVSCDCGLCFRVNQFLSESCSFKAVRIHGSSTAFDHVRHYLTGL
REGISCDFAIDAASGTITVTKRLNPDPTALKQWEIKKNKMKKQIFAKFDQAKLRAILGEE
YLWFTGFQFLENNLEIEVHDEKELPPPPVHSAPLLGKPIDHFIIGRPDLSTPSAQGYRQP
VAAHQNHHHPFHQSTVSGYQGPQPGQARPQPVGTYYSYQLPPPNQGHRAPANPWAYSDPT
SQSTQSGNFISAYSDGFAGSIQMTNNVNNPQTTTHIQDTLEHGRQLFFFEEQIVIQRQFP
SWQSGAINAELWRRWTTMASSRQESYVSRATVAQNQAQTQAHPSLPAPHHSAPQPSGSSL
SAEDDLKAGREYYFSTQMGSLRAKHPTYSHQLLLDKISTAWSSLPRTHREWFNKQALLQK
QQQPQLAPLDNARAVGPSGTRSIPSLSSIAPPPPPSVVPGMLPDQAQPFPSVQSRVAALR
EEAKVTLTTALAIAKPVVDKNGMVAVRTSTRLSIPEQDYMESKARLAPYPNVAHLDPCRK
DLNRGRTWWINKYTDGLSRLLSGTSEQQIRQQLGVEWETCLTMGDRLRTDDMARIEEAKS
ALARERNSLNEVMLQRATKRARTYGASTSATAAGSTQKGPASASATSPPVSGYEVFAKEM
EGRLRKRNSGASAASLKSVIQRRWEAMSETHRAVYATMALDKAKSGSGTVAPSTSTSTST
STSTSTSTSTSTSTSTSTSAISASTSTAAPSRKYDGFEYYLNTEGLNVRRKYPEYSYDQV
VEATKRQWDALTSTARSNYSNKAFAAAQHPLDKGIFTWLEDTFKRVAKDKATVSSTPAAQ
NYSASSSSSSGPPQDAGFEFWLKFEERKFRDKNPGLTYEETMARRIYEDMAAKAKVNADI
TVKPTASQAPPSSSSAATASTIGDCSQYDSPSEYGRYDGFTWFLNSEGVDYKKQNPNVAY
SDLRTAMYARWCGMDGIERSKFEKVASTLKQSAEGREMFNGLREAYSLPPGQDPHERLAA
ARCRSPSDAGRYDGFTWFYNSVGVSLKKQIPDIGYDEHRTEIYSQWSGLKAMQRREYEKV
AYTLRQSAQGRALFNRLREAFDLPPERDPRSWIPSPPPNTASATSAAAAVSSSTTSSNAT
SSMTREDWERKYDGWSFYLNTAGTLHCDRRTSYDSVVAKMKARWKSMSAVERLAYEDGAK
AARMSGRRQVTFNNLRIACGLPEEPIPPPPAHGAPRVPTSLSATATASTASSSAPSSNAS
RSITWEAWAHKYGGFNWFLNTWGHAFKQENRELDYELVVTITESRWERMTHEERRDFEDK
AKRMRVNVAGRRMFNKLRELCGLPEEPDMPEPAKTVTPRTPFPSTWRGSGLKAATPLLSS
SPTRPDPASFSPADRALMEIEPNRMAAPSSSAAPATPGLSNKVAKIDITSAWAVKSSRLK
IPPLTPRSGGGSASAFGSGSKSAPRGVKRKAEPDVIDLTLDD
Download sequence
Identical sequences jgi|Neute1|161292|estExt_fgenesh1_pg.C_760012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]